PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C03555.1.p
Common NameEUGRSUZ_C03555, LOC104438145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 289aa    MW: 32672.5 Da    PI: 6.619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C03555.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.3e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg WT+ Ed++lvd+++ +G g W+  +++ g++R++k+c++rw++yl
  Eucgr.C03555.1.p 14 RGIWTAGEDKILVDYIEAHGEGKWRDLPQRAGLKRCGKSCRLRWLNYL 61
                      788*******************************************97 PP

2Myb_DNA-binding51.62.1e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ + +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  Eucgr.C03555.1.p  67 RGNISMDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNHWNTN 111
                       788899****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.219961IPR017930Myb domain
SuperFamilySSF466895.87E-2912108IPR009057Homeodomain-like
SMARTSM007171.8E-111363IPR001005SANT/Myb domain
PfamPF002491.3E-131461IPR001005SANT/Myb domain
CDDcd001678.18E-91761No hitNo description
PROSITE profilePS5129425.07462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2365116IPR009057Homeodomain-like
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002492.3E-1467112IPR001005SANT/Myb domain
CDDcd001672.27E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRRPCCAKE GLNRGIWTAG EDKILVDYIE AHGEGKWRDL PQRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI SMDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNHWNT NLSKKVQDQT  120
HQNPVKRSNE LEPRSETSKE ESPSRLEPHP VIRTKAIRCT RVILPPPLMD QVASKATSFR  180
NSNSETSSYT SSRQSDLSSH FLADFNIDDL LMSDEAQNLD SCFPLEGEKV NCYPSNFTLP  240
AHDDAGCIRS EGLDRWRDND EPFQPNGSFD FNSLASFLNS DDGCGLDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C03555.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010049530.10.0PREDICTED: transcription factor TT2-like
SwissprotQ9FJA25e-66TT2_ARATH; Transcription factor TT2
TrEMBLA0A059CUV10.0A0A059CUV1_EUCGR; Uncharacterized protein
STRINGVIT_11s0016g01320.t017e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-65MYB family protein